RPS27L (NM_015920) Human Mass Spec Standard
CAT#: PH302658
RPS27L MS Standard C13 and N15-labeled recombinant protein (NP_057004)
View other "RPS27L" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RPS27L MS Standard C13 and N15-labeled recombinant protein (NP_057004) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202658 |
Predicted MW | 9.5 kDa |
Protein Sequence |
>RC202658 protein sequence
Red=Cloning site Green=Tags(s) MPLARDLLHPSLEEEKKKHKEKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGK ARLTEGCSFRRKQH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057004 |
RefSeq Size | 1084 |
RefSeq ORF | 252 |
Locus ID | 51065 |
Cytogenetics | 15q22.2 |
Summary | This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit. [provided by RefSeq, Jul 2008] |
Protein Pathways | Ribosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414323 | RPS27L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414323 | Transient overexpression lysate of ribosomal protein S27-like (RPS27L) |
CNY 3,080.00 |
|
TP302658 | Recombinant protein of human ribosomal protein S27-like (RPS27L), 20 µg |
CNY 2,900.00 |