HIF1AN (NM_017902) Human Mass Spec Standard
CAT#: PH302843
HIF1AN MS Standard C13 and N15-labeled recombinant protein (NP_060372)
View other "HIF1AN" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HIF1AN MS Standard C13 and N15-labeled recombinant protein (NP_060372) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202843 |
Predicted MW | 40.3 kDa |
Protein Sequence |
>RC202843 protein sequence
Red=Cloning site Green=Tags(s) MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLV YPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGG EERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQI KGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHH IESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060372 |
RefSeq Size | 6928 |
RefSeq ORF | 1047 |
Synonyms | FIH1 |
Locus ID | 55662 |
Cytogenetics | 10q24.31 |
Summary | Hydroxylates HIF-1 alpha at 'Asn-803' in the C-terminal transactivation domain (CAD). Functions as an oxygen sensor and, under normoxic conditions, the hydroxylation prevents interaction of HIF-1 with transcriptional coactivators including Cbp/p300-interacting transactivator. Involved in transcriptional repression through interaction with HIF1A, VHL and histone deacetylases. Hydroxylates specific Asn residues within ankyrin repeat domains (ARD) of NFKB1, NFKBIA, NOTCH1, ASB4, PPP1R12A and several other ARD-containing proteins. Also hydroxylates Asp and His residues within ARDs of ANK1 and TNKS2, respectively. Negatively regulates NOTCH1 activity, accelerating myogenic differentiation. Positively regulates ASB4 activity, promoting vascular differentiation.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402628 | HIF1AN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402628 | Transient overexpression lysate of hypoxia inducible factor 1, alpha subunit inhibitor (HIF1AN) |
CNY 3,080.00 |
|
TP302843 | Recombinant protein of human hypoxia inducible factor 1, alpha subunit inhibitor (HIF1AN), 20 µg |
CNY 2,900.00 |