HLA DOB (HLA-DOB) (NM_002120) Human Mass Spec Standard
CAT#: PH302892
HLA MS Standard C13 and N15-labeled recombinant protein (NP_002111)
View other "HLA DOB" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HLA MS Standard C13 and N15-labeled recombinant protein (NP_002111) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202892 |
Predicted MW | 30.8 kDa |
Protein Sequence |
>RC202892 protein sequence
Red=Cloning site Green=Tags(s) MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDV GMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNL LHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWTFQTVVMLEMTPELGHVYTCLVDHSSLLSPV SVEWRAQSEYSWRKMLSGIAAFLLGLIFLLVGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002111 |
RefSeq Size | 1388 |
RefSeq ORF | 819 |
Synonyms | DOB; HLA_DOB |
Locus ID | 3112 |
Cytogenetics | 6p21.32 |
Summary | HLA-DOB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DOA) and a beta chain (DOB), both anchored in the membrane. It is located in intracellular vesicles. DO suppresses peptide loading of MHC class II molecules by inhibiting HLA-DM. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Protein Pathways | Allograft rejection, Antigen processing and presentation, Asthma, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Graft-versus-host disease, Systemic lupus erythematosus, Type I diabetes mellitus, Viral myocarditis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400772 | HLA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400772 | Transient overexpression lysate of major histocompatibility complex, class II, DO beta (HLA-DOB) |
CNY 3,080.00 |
|
TP302892 | Recombinant protein of human major histocompatibility complex, class II, DO beta (HLA-DOB), 20 µg |
CNY 2,900.00 |
其它HLA DOB产品