HYI (NM_031207) Human Mass Spec Standard
CAT#: PH302991
HYI MS Standard C13 and N15-labeled recombinant protein (NP_112484)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HYI MS Standard C13 and N15-labeled recombinant protein (NP_112484) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202991 |
Predicted MW | 24.1 kDa |
Protein Sequence |
>RC202991 protein sequence
Red=Cloning site Green=Tags(s) MGLGAVPGRQAAFREGLEQAVRYAKALGCPRIHLMAGRVPQGADRIAVKAEMEAVFLENLRHAAGVLAQE DLVGLLEPINTRITDPQYFLDTPQQAAAILQKVGRPNLQLQMDIFHWQIMDGNLTGNIREFLPIVGHVQV AQVPGRGEPSSPGELNFPYLFQLLENEGYKGFVGCEYQPRGDTVEGLSWLRSYWDRRATQRLASEGPHTT HVPPDSE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_112484 |
RefSeq Size | 1251 |
RefSeq ORF | 1365 |
Synonyms | HT036 |
Locus ID | 81888 |
Cytogenetics | 1p34.2 |
Summary | This gene encodes a putative hydroxypyruvate isomerase, which likely catalyzes the conversion of hydroxypyruvate to 2-hydroxy-3-oxopropanoate, and may be involved in carbohydrate transport and metabolism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
Protein Pathways | Glyoxylate and dicarboxylate metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410587 | HYI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434117 | HYI HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410587 | Transient overexpression lysate of hydroxypyruvate isomerase homolog (E. coli) (HYI) |
CNY 3,080.00 |
|
LY434117 | Transient overexpression lysate of hydroxypyruvate isomerase (putative) (HYI), transcript variant 3 |
CNY 3,080.00 |
|
TP302991 | Recombinant protein of human hydroxypyruvate isomerase homolog (E. coli) (HYI), 20 µg |
CNY 2,900.00 |
|
TP331118 | Recombinant protein of human hydroxypyruvate isomerase (putative) (HYI), transcript variant 3, 20 µg |
CNY 2,900.00 |