FXC1 (TIMM10B) (NM_012192) Human Mass Spec Standard
CAT#: PH303083
FXC1 MS Standard C13 and N15-labeled recombinant protein (NP_036324)
View other "FXC1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FXC1 MS Standard C13 and N15-labeled recombinant protein (NP_036324) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203083 |
Predicted MW | 11.6 kDa |
Protein Sequence |
>RC203083 protein sequence
Red=Cloning site Green=Tags(s) MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQL MPALVQRRIADYEAASAVPSVAAEQPGVSPSGS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036324 |
RefSeq Size | 2861 |
RefSeq ORF | 309 |
Synonyms | FXC1; Tim9b; TIM10B |
Locus ID | 26515 |
Cytogenetics | 11p15.4 |
Summary | FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM, Apr 2004] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415921 | TIMM10B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415921 | Transient overexpression lysate of fracture callus 1 homolog (rat) (FXC1), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP303083 | Recombinant protein of human fracture callus 1 homolog (rat) (FXC1), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |