GST3 (GSTP1) (NM_000852) Human Mass Spec Standard
CAT#: PH303086
GSTP1 MS Standard C13 and N15-labeled recombinant protein (NP_000843)
View other "GST3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | GSTP1 MS Standard C13 and N15-labeled recombinant protein (NP_000843) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203086 |
Predicted MW | 23.3 kDa |
Protein Sequence |
>RC203086 protein sequence
Red=Cloning site Green=Tags(s) MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTIL RHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGG KTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000843 |
RefSeq Size | 986 |
RefSeq ORF | 630 |
Synonyms | DFN7; FAEES3; GST3; GSTP; HEL-S-22; PI |
Locus ID | 2950 |
Cytogenetics | 11q13.2 |
Summary | Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450, Pathways in cancer, Prostate cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400300 | GSTP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400300 | Transient overexpression lysate of glutathione S-transferase pi 1 (GSTP1) |
CNY 3,080.00 |
|
TP303086 | Recombinant protein of human glutathione S-transferase pi 1 (GSTP1), 20 µg |
CNY 2,900.00 |