HRSP12 (RIDA) (NM_005836) Human Mass Spec Standard
CAT#: PH303107
HRSP12 MS Standard C13 and N15-labeled recombinant protein (NP_005827)
View other "HRSP12" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HRSP12 MS Standard C13 and N15-labeled recombinant protein (NP_005827) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203107 |
Predicted MW | 14.5 kDa |
Protein Sequence |
>RC203107 protein sequence
Red=Cloning site Green=Tags(s) MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAG CDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGPLTTASL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005827 |
RefSeq Size | 1011 |
RefSeq ORF | 411 |
Synonyms | hp14.5; HRSP12; P14.5; PSP; UK114 |
Locus ID | 10247 |
Cytogenetics | 8q22.2 |
Summary | Catalyzes the hydrolytic deamination of enamine/imine intermediates that form during the course of normal metabolism. May facilitate the release of ammonia from these potentially toxic reactive metabolites, reducing their impact on cellular components. It may act on enamine/imine intermediates formed by several types of pyridoxal-5'-phosphate-dependent dehydratases including L-threonine dehydratase.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417023 | HRSP12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417023 | Transient overexpression lysate of heat-responsive protein 12 (HRSP12) |
CNY 3,080.00 |
|
TP303107 | Recombinant protein of human heat-responsive protein 12 (HRSP12), 20 µg |
CNY 2,900.00 |
|
TP720229 | Recombinant protein of human heat-responsive protein 12 (HRSP12) |
CNY 3,140.00 |