United States
Germany
Japan
United Kingdom
China
Myoglobin (MB) (NM_203378) Human Mass Spec Standard
CAT＃: PH303113
MB MS Standard C13 and N15-labeled recombinant protein (NP_976312)
View other "Myoglobin" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | MB MS Standard C13 and N15-labeled recombinant protein (NP_976312) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203113 |
| Predicted MW | 17.2 kDa |
| Protein Sequence |
>RC203113 protein sequence
Red=Cloning site Green=Tags(s) MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVL TALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFR KDMASNYKELGFQG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_976312 |
| RefSeq Size | 1153 |
| RefSeq ORF | 462 |
| Synonyms | PVALB |
| Locus ID | 4151 |
| Cytogenetics | 22q12.3 |
| Summary | This gene encodes a member of the globin superfamily and is predominantly expressed in skeletal and cardiac muscles. The encoded protein forms a monomeric globular haemoprotein that is primarily responsible for the storage and facilitated transfer of oxygen from the cell membrane to the mitochondria. This protein also plays a role in regulating physiological levels of nitric oxide. Multiple transcript variants encoding distinct isoforms exist for this gene. [provided by RefSeq, May 2020] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404319 | MB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404320 | MB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417346 | MB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404319 | Transient overexpression lysate of myoglobin (MB), transcript variant 2 |
CNY 3,080.00 |
|
| LY404320 | Transient overexpression lysate of myoglobin (MB), transcript variant 3 |
CNY 3,080.00 |
|
| LY417346 | Transient overexpression lysate of myoglobin (MB), transcript variant 1 |
CNY 3,080.00 |
|
| PH312352 | MB MS Standard C13 and N15-labeled recombinant protein (NP_005359) |
CNY 19,520.00 |
|
| TP303113 | Recombinant protein of human myoglobin (MB), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP312352 | Recombinant protein of human myoglobin (MB), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP761636 | Purified recombinant protein of Human myoglobin (MB), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它Myoglobin产品
