GAP43 (NM_002045) Human Mass Spec Standard
CAT#: PH303175
GAP43 MS Standard C13 and N15-labeled recombinant protein (NP_002036)
View other "GAP43" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GAP43 MS Standard C13 and N15-labeled recombinant protein (NP_002036) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203175 |
Predicted MW | 24.8 kDa |
Protein Sequence |
>RC203175 protein sequence
Red=Cloning site Green=Tags(s) MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKD EAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAET ESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIE AVDETKPKESARQDEGKEEEPEADQEHA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002036 |
RefSeq Size | 1747 |
RefSeq ORF | 714 |
Synonyms | B-50; GAP-43; PP46 |
Locus ID | 2596 |
Cytogenetics | 3q13.31 |
Summary | The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400750 | GAP43 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400750 | Transient overexpression lysate of growth associated protein 43 (GAP43), transcript variant 2 |
CNY 3,080.00 |
|
TP303175 | Recombinant protein of human growth associated protein 43 (GAP43), transcript variant 2, 20 µg |
CNY 2,900.00 |