COLEC11 (NM_199235) Human Mass Spec Standard
CAT#: PH303199
COLEC11 MS Standard C13 and N15-labeled recombinant protein (NP_954705)
View other "COLEC11" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | COLEC11 MS Standard C13 and N15-labeled recombinant protein (NP_954705) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203199 |
Predicted MW | 29 kDa |
Protein Sequence |
>RC203199 protein sequence
Red=Cloning site Green=Tags(s) MTPALCRSSSLASKGMRERRETKAPPDGLEESAPREKKQSQPVVTASDISKRKCTSSFVEMGSQGDMGDK GQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAV AGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGA FVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_954705 |
RefSeq Size | 1784 |
RefSeq ORF | 804 |
Synonyms | 3MC2; CL-11; CL-K1-I; CL-K1-II; CL-K1-IIa; CL-K1-IIb; CLK1 |
Locus ID | 78989 |
Cytogenetics | 2p25.3 |
Summary | This gene encodes a member of the collectin family of C-type lectins that possess collagen-like sequences and carbohydrate recognition domains. Collectins are secreted proteins that play important roles in the innate immune system by binding to carbohydrate antigens on microorganisms, facilitating their recognition and removal. The encoded protein binds to multiple sugars with a preference for fucose and mannose. Mutations in this gene are a cause of 3MC syndrome-2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404629 | COLEC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411405 | COLEC11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404629 | Transient overexpression lysate of collectin sub-family member 11 (COLEC11), transcript variant 2 |
CNY 3,080.00 |
|
LY411405 | Transient overexpression lysate of collectin sub-family member 11 (COLEC11), transcript variant 1 |
CNY 3,080.00 |
|
TP303199 | Recombinant protein of human collectin sub-family member 11 (COLEC11), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它COLEC11产品