PSG3 (NM_021016) Human Mass Spec Standard
CAT#: PH303252
PSG3 MS Standard C13 and N15-labeled recombinant protein (NP_066296)
View other "PSG3" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PSG3 MS Standard C13 and N15-labeled recombinant protein (NP_066296) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203252 |
Predicted MW | 47.9 kDa |
Protein Sequence |
>RC203252 protein sequence
Red=Cloning site Green=Tags(s) MGPLSAPPCTQRITWKGLLLTALLLNFWNLPTTAQVTIEAEPTKVSKGKDVLLLVHNLPQNLAGYIWYKG QMKDLYHYITSYVVDGQIIIYGPAYSGRETVYSNASLLIQNVTREDAGSYTLHIVKRGDGTRGETGHFTF TLYLETPKPSISSSNLYPREDMEAVSLTCDPETPDASYLWWMNGQSLPMTHSLQLSKNKRTLFLFGVTKY TAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVLAFTCEPKSENYTYIWWLNGQSL PVSPRVKRPIENRILILPSVTRNETGPYQCEIQDRYGGIRSYPVTLNVLYGPDLPRIYPSFTYYHSGENL YLSCFADSNPPAEYSWTINGKFQLSGQKLFIPQITTKHSGLYACSVRNSATGMESSKSMTVEVSAPSGTG HLPGLNPL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_066296 |
RefSeq Size | 1922 |
RefSeq ORF | 1284 |
Locus ID | 5671 |
Cytogenetics | 19q13.2 |
Summary | The human pregnancy-specific glycoproteins (PSGs) are a family of proteins that are synthesized in large amounts by placental trophoblasts and released into the maternal circulation during pregnancy. Molecular cloning and analysis of several PSG genes has indicated that the PSGs form a subgroup of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily of genes. Members of the CEA family consist of a single N domain, with structural similarity to the immunoglobulin variable domains, followed by a variable number of immunoglobulin constant-like A and/or B domains. Most PSGs have an arg-gly-asp (RGD) motif, which has been shown to function as an adhesion recognition signal for several integrins, in the N-terminal domain (summary by Teglund et al., 1994 [PubMed 7851896]). For additional general information about the PSG gene family, see PSG1 (MIM 176390).[supplied by OMIM, Oct 2009] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412142 | PSG3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412142 | Transient overexpression lysate of pregnancy specific beta-1-glycoprotein 3 (PSG3) |
CNY 3,080.00 |
|
TP303252 | Recombinant protein of human pregnancy specific beta-1-glycoprotein 3 (PSG3), 20 µg |
CNY 2,900.00 |
|
TP721115 | Purified recombinant protein of Human pregnancy specific beta-1-glycoprotein 3 (PSG3) |
CNY 5,460.00 |