Calprotectin (S100A8) (NM_002964) Human Mass Spec Standard
CAT#: PH303255
S100A8 MS Standard C13 and N15-labeled recombinant protein (NP_002955)
View other "S100A8" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | S100A8 MS Standard C13 and N15-labeled recombinant protein (NP_002955) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203255 |
Predicted MW | 11.3 kDa |
Protein Sequence |
>RC203255 representing NM_002964
Red=Cloning site Green=Tags(s) MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQE FLILVIKMGVAAHKKSHEESHKE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002955 |
RefSeq Size | 532 |
RefSeq ORF | 279 |
Synonyms | 60B8AG; CAGA; CFAG; CGLA; CP-10; L1Ag; MA387; MIF; MRP8; NIF; P8 |
Locus ID | 6279 |
Cytogenetics | 1q21.3 |
Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP303255 | Purified recombinant protein of Homo sapiens S100 calcium binding protein A8 (S100A8), 20 µg |
CNY 2,900.00 |
|
TP750184 | Purified recombinant protein of Human S100 calcium binding protein A8 (S100A8), full length, with C-terminal His tag, expressed in E.coli, 50ug |
CNY 2,840.00 |
|
TP750185 | Purified recombinant protein of Human Calprotectin antigen (S100A8/S100A9), full length, with C-His tag in the S100A8 and C-DDK Tag in the S100A9, expressed in E.coli, 50ug |
CNY 2,840.00 |