C1D (NM_173177) Human Mass Spec Standard
CAT#: PH303301
C1D MS Standard C13 and N15-labeled recombinant protein (NP_775269)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | C1D MS Standard C13 and N15-labeled recombinant protein (NP_775269) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203301 |
Predicted MW | 16 kDa |
Protein Sequence |
>RC203301 protein sequence
Red=Cloning site Green=Tags(s) MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVY LATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSK S myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_775269 |
RefSeq Size | 1194 |
RefSeq ORF | 423 |
Synonyms | hC1D; LRP1; Rrp47; SUN-CoR; SUNCOR |
Locus ID | 10438 |
Cytogenetics | 2p14 |
Summary | The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Alternate splicing results in multiple transcript variants that encode the same protein. Multiple pseudogenes of this gene are found on chromosome 10.[provided by RefSeq, Jun 2010] |
Protein Families | Druggable Genome |
Protein Pathways | RNA degradation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406634 | C1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416720 | C1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406634 | Transient overexpression lysate of C1D nuclear receptor co-repressor (C1D), transcript variant 2 |
CNY 3,080.00 |
|
LY416720 | Transient overexpression lysate of C1D nuclear receptor co-repressor (C1D), transcript variant 1 |
CNY 3,080.00 |
|
PH302688 | C1D MS Standard C13 and N15-labeled recombinant protein (NP_006324) |
CNY 19,520.00 |
|
TP302688 | Recombinant protein of human C1D nuclear receptor co-repressor (C1D), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP303301 | Recombinant protein of human C1D nuclear receptor co-repressor (C1D), transcript variant 2, 20 µg |
CNY 2,900.00 |