RGS10 (NM_001005339) Human Mass Spec Standard
CAT#: PH303488
RGS10 MS Standard C13 and N15-labeled recombinant protein (NP_001005339)
View other "RGS10" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | RGS10 MS Standard C13 and N15-labeled recombinant protein (NP_001005339) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203488 |
Predicted MW | 21.2 kDa |
Protein Sequence |
>RC203488 protein sequence
Red=Cloning site Green=Tags(s) MFNRAVSRLSRKRPPSDIHDSDGSSSSSHQSLKSTAKWAASLENLLEDPEGVKRFREFLKKEFSEENVLF WLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNEKILEEPHPLMFQKLQDQIFNLMKY DSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001005339 |
RefSeq Size | 910 |
RefSeq ORF | 543 |
Locus ID | 6001 |
Cytogenetics | 10q26.11 |
Summary | Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 10 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein associates specifically with the activated forms of the two related G-protein subunits, G-alphai3 and G-alphaz but fails to interact with the structurally and functionally distinct G-alpha subunits. Regulator of G protein signaling 10 protein is localized in the nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419006 | RGS10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423865 | RGS10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419006 | Transient overexpression lysate of regulator of G-protein signaling 10 (RGS10), transcript variant 2 |
CNY 3,080.00 |
|
LY423865 | Transient overexpression lysate of regulator of G-protein signaling 10 (RGS10), transcript variant 1 |
CNY 3,080.00 |
|
PH315410 | RGS10 MS Standard C13 and N15-labeled recombinant protein (NP_002916) |
CNY 19,520.00 |
|
TP303488 | Recombinant protein of human regulator of G-protein signaling 10 (RGS10), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP315410 | Recombinant protein of human regulator of G-protein signaling 10 (RGS10), transcript variant 2, 20 µg |
CNY 2,900.00 |