RRAGA (NM_006570) Human Mass Spec Standard
CAT#: PH303493
RRAGA MS Standard C13 and N15-labeled recombinant protein (NP_006561)
View other "RRAGA" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RRAGA MS Standard C13 and N15-labeled recombinant protein (NP_006561) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203493 |
Predicted MW | 36.6 kDa |
Protein Sequence |
>RC203493 protein sequence
Red=Cloning site Green=Tags(s) MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFM ENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLI FKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAQIIEADEVLLFERAT FLVISHYQCKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPS IPSAATLINIRNARKHFEKLERVDGPKHSLLMR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006561 |
RefSeq Size | 1657 |
RefSeq ORF | 939 |
Synonyms | FIP-1; FIP1; RAGA |
Locus ID | 10670 |
Cytogenetics | 9p22.1 |
Summary | Guanine nucleotide-binding protein that plays a crucial role in the cellular response to amino acid availability through regulation of the mTORC1 signaling cascade. Forms heterodimeric Rag complexes with RRAGC or RRAGD and cycles between an inactive GDP-bound and an active GTP-bound form. In its active form participates in the relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. Involved in the RCC1/Ran-GTPase pathway. May play a direct role in a TNF-alpha signaling pathway leading to induction of cell death. May alternatively act as a cellular target for adenovirus E3-14.7K, an inhibitor of TNF-alpha functions, thereby affecting cell death.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416559 | RRAGA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416559 | Transient overexpression lysate of Ras-related GTP binding A (RRAGA) |
CNY 3,080.00 |
|
TP303493 | Recombinant protein of human Ras-related GTP binding A (RRAGA), 20 µg |
CNY 2,900.00 |