BSCL2 (NM_032667) Human Mass Spec Standard
CAT#: PH303625
BSCL2 MS Standard C13 and N15-labeled recombinant protein (NP_116056)
View other "BSCL2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | BSCL2 MS Standard C13 and N15-labeled recombinant protein (NP_116056) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203625 |
Predicted MW | 44.2 kDa |
Protein Sequence |
>RC203625 representing NM_032667
Red=Cloning site Green=Tags(s) MVNDPPVPALLWAQEVGQVLAGRARRLLLQFGVLFCTILLLLWVSVFLYGSFYYSYMPTVSHLSPVHFYY RTDCDSSTTSLCSFPVANVSLTKGGRDRVLMYGQPYRVTLELELPESPVNQDLGMFLVTISCYTRGGRII STSSRSVMLHYRSDLLQMLDTLVFSSLLLFGFAEQKQLLEVELYADYRENSYVPTTGAIIEIHSKRIQLY GAYLRIHAHFTGLRYLLYNFPMTCAFIGVASNFTFLSVIVLFSYMQWVWGGIWPRHRFSLQVNIRKRDNS RKEVQRRISAHQPGAGPEGQEESTPQSDVTEDGESPEDPSGTEGQLSEEEKPDQQPLSGEEELEPEASDG SGSWEDAALLTEANLPAPAPASASAPVLETLGSSEPAGGALRQRPTCSSS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_116056 |
RefSeq Size | 1664 |
RefSeq ORF | 1200 |
Synonyms | GNG3LG; HMN5; HMN5C; PELD; SPG17 |
Locus ID | 26580 |
Cytogenetics | 11q12.3 |
Summary | This gene encodes the multi-pass transmembrane protein protein seipin. This protein localizes to the endoplasmic reticulum and may be important for lipid droplet morphology. Mutations in this gene have been associated with congenital generalized lipodystrophy type 2 or Berardinelli-Seip syndrome, a rare autosomal recessive disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HNRNPUL2 (heterogeneous nuclear ribonucleoprotein U-like 2).[provided by RefSeq, Mar 2011] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403190 | BSCL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403190 | Transient overexpression lysate of Berardinelli-Seip congenital lipodystrophy 2 (seipin) (BSCL2), transcript variant 2 |
CNY 3,080.00 |
|
TP303625 | Recombinant protein of human Bernardinelli-Seip congenital lipodystrophy 2 (seipin) (BSCL2), transcript variant 2, 20 µg |
CNY 2,900.00 |