Macro H2A.2 (H2AFY2) (NM_018649) Human Mass Spec Standard
CAT#: PH303699
H2AFY2 MS Standard C13 and N15-labeled recombinant protein (NP_061119)
View other "Macro H2A.2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | H2AFY2 MS Standard C13 and N15-labeled recombinant protein (NP_061119) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203699 |
Predicted MW | 40.1 kDa |
Protein Sequence |
>RC203699 protein sequence
Red=Cloning site Green=Tags(s) MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARD NKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKAT SGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSM RVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQ WGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVY FLLFDSESIGIYVQEMAKLDAK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061119 |
RefSeq Size | 2181 |
RefSeq ORF | 1116 |
Synonyms | H2AFY2 |
Locus ID | 55506 |
Cytogenetics | 10q22.1 |
Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and may participate in stable X chromosome inactivation. [provided by RefSeq, Oct 2015] |
Protein Pathways | Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412957 | H2AFY2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412957 | Transient overexpression lysate of H2A histone family, member Y2 (H2AFY2) |
CNY 3,080.00 |
|
TP303699 | Recombinant protein of human H2A histone family, member Y2 (H2AFY2), 20 µg |
CNY 2,900.00 |
其它Macro H2A.2产品