DNAJB4 (NM_007034) Human Mass Spec Standard
CAT#: PH303743
DNAJB4 MS Standard C13 and N15-labeled recombinant protein (NP_008965)
View other "DNAJB4" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | DNAJB4 MS Standard C13 and N15-labeled recombinant protein (NP_008965) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203743 |
Predicted MW | 37.8 kDa |
Protein Sequence |
>RC203743 protein sequence
Red=Cloning site Green=Tags(s) MGKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQFGEE GLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMN GYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYSGCTKRMKISRKRLNADGRSYRSEDKILTIEIKKGWKE GTKITFPREGDETPNSIPADIVFIIKDKDHPKFKRDGSNIIYTAKISLREALCGCSINVPTLDGRNIPMS VNDIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLPAS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_008965 |
RefSeq Size | 2250 |
RefSeq ORF | 1011 |
Synonyms | DjB4; DNAJW; HLJ1 |
Locus ID | 11080 |
Cytogenetics | 1p31.1 |
Summary | The protein encoded by this gene is a molecular chaperone, tumor suppressor, and member of the heat shock protein-40 family. The encoded protein binds the cell adhesion protein E-cadherin and targets it to the plasma membrane. This protein also binds incorrectly folded E-cadherin and targets it for endoplasmic reticulum-associated degradation. This gene is a strong tumor suppressor for colorectal carcinoma, and downregulation of it may serve as a good biomarker for predicting patient outcomes. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402104 | DNAJB4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402104 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 4 (DNAJB4) |
CNY 3,080.00 |
|
TP303743 | Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 4 (DNAJB4), 20 µg |
CNY 2,900.00 |