RGS13 (NM_144766) Human Mass Spec Standard
CAT#: PH303804
RGS13 MS Standard C13 and N15-labeled recombinant protein (NP_658912)
View other "RGS13" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | RGS13 MS Standard C13 and N15-labeled recombinant protein (NP_658912) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203804 |
Predicted MW | 19.1 kDa |
Protein Sequence |
>RC203804 protein sequence
Red=Cloning site Green=Tags(s) MSRRNCWICKMCRDESKRPPSNLTLEEVLQWAQSFENLMATKYGPVVYAAYLKMEHSDENIQFWMACETY KKIASRWSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQKIVYMHMERDSYPRF LKSEMYQKLLKTMQSNNSF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_658912 |
RefSeq Size | 1538 |
RefSeq ORF | 477 |
Locus ID | 6003 |
Cytogenetics | 1q31.2 |
Summary | The protein encoded by this gene is a member of the regulator of G protein signaling (RGS) family. RGS family members share similarity with S. cerevisiae SST2 and C. elegans egl-10 proteins, which contain a characteristic conserved RGS domain. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their inactive GDP-bound form, thus negatively regulating G protein signaling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation. The biological function of this gene, however, is unknown. Two transcript variants encoding the same isoform exist. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408107 | RGS13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419008 | RGS13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429127 | RGS13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408107 | Transient overexpression lysate of regulator of G-protein signaling 13 (RGS13), transcript variant 2 |
CNY 3,080.00 |
|
LY419008 | Transient overexpression lysate of regulator of G-protein signaling 13 (RGS13), transcript variant 1 |
CNY 3,080.00 |
|
TP303804 | Recombinant protein of human regulator of G-protein signaling 13 (RGS13), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP761510 | Purified recombinant protein of Human regulator of G-protein signaling 13 (RGS13), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |