United States
Germany
Japan
United Kingdom
China
Nucleophosmin (NPM1) (NM_199185) Human Mass Spec Standard
CAT＃: PH303841
NPM1 MS Standard C13 and N15-labeled recombinant protein (NP_954654)
View other "Nucleophosmin" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | NPM1 MS Standard C13 and N15-labeled recombinant protein (NP_954654) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203841 |
| Predicted MW | 29.5 kDa |
| Protein Sequence |
>RC203841 protein sequence
Red=Cloning site Green=Tags(s) MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGS PIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISG KRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKGQESFKKQEKTPKTPK GPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_954654 |
| RefSeq Size | 1362 |
| RefSeq ORF | 795 |
| Synonyms | B23; NPM |
| Locus ID | 4869 |
| Cytogenetics | 5q35.1 |
| Summary | The protein encoded by this gene is involved in several cellular processes, including centrosome duplication, protein chaperoning, and cell proliferation. The encoded phosphoprotein shuttles between the nucleolus, nucleus, and cytoplasm, chaperoning ribosomal proteins and core histones from the nucleus to the cytoplasm. This protein is also known to sequester the tumor suppressor ARF in the nucleolus, protecting it from degradation until it is needed. Mutations in this gene are associated with acute myeloid leukemia. Dozens of pseudogenes of this gene have been identified. [provided by RefSeq, Aug 2017] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404681 | NPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419282 | NPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421985 | NPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404681 | Transient overexpression lysate of nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 2 |
CNY 3,080.00 |
|
| LY419282 | Transient overexpression lysate of nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 1 |
CNY 3,080.00 |
|
| LY421985 | Transient overexpression lysate of nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 3 |
CNY 3,080.00 |
|
| PH303344 | NPM1 MS Standard C13 and N15-labeled recombinant protein (NP_002511) |
CNY 19,520.00 |
|
| PH310458 | NPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001032827) |
CNY 19,520.00 |
|
| TP303344 | Recombinant protein of human nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP303841 | Recombinant protein of human nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP310458 | Recombinant protein of human nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它Nucleophosmin产品
