GNGT2 (NM_031498) Human Mass Spec Standard
CAT#: PH303892
GNGT2 MS Standard C13 and N15-labeled recombinant protein (NP_113686)
View other "GNGT2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GNGT2 MS Standard C13 and N15-labeled recombinant protein (NP_113686) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203892 |
Predicted MW | 7.7 kDa |
Protein Sequence |
>RC203892 protein sequence
Red=Cloning site Green=Tags(s) MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_113686 |
RefSeq Size | 1057 |
RefSeq ORF | 207 |
Synonyms | G-GAMMA-8; G-GAMMA-C; GNG9; GNGT8 |
Locus ID | 2793 |
Cytogenetics | 17q21.32 |
Summary | Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Nov 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Chemokine signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410491 | GNGT2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410491 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 (GNGT2) |
CNY 3,080.00 |
|
TP303892 | Recombinant protein of human guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 (GNGT2), 20 µg |
CNY 2,900.00 |