TAZ (WWTR1) (NM_015472) Human Mass Spec Standard
CAT#: PH304082
WWTR1 MS Standard C13 and N15-labeled recombinant protein (NP_056287)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | WWTR1 MS Standard C13 and N15-labeled recombinant protein (NP_056287) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204082 |
Predicted MW | 44.1 kDa |
Protein Sequence |
>RC204082 protein sequence
Red=Cloning site Green=Tags(s) MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSS GGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQR YFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHP TQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVN PPTMTPDMRSITNNSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNI NPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_056287 |
RefSeq Size | 5135 |
RefSeq ORF | 1200 |
Synonyms | TAZ |
Locus ID | 25937 |
Cytogenetics | 3q25.1 |
Summary | Transcriptional coactivator which acts as a downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. WWTR1 enhances PAX8 and NKX2-1/TTF1-dependent gene activation. Regulates the nuclear accumulation of SMADS and has a key role in coupling them to the transcriptional machinery such as the mediator complex. Regulates embryonic stem-cell self-renewal, promotes cell proliferation and epithelial-mesenchymal transition.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414524 | WWTR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433001 | WWTR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414524 | Transient overexpression lysate of WW domain containing transcription regulator 1 (WWTR1), transcript variant 1 |
CNY 3,080.00 |
|
LY433001 | Transient overexpression lysate of WW domain containing transcription regulator 1 (WWTR1), transcript variant 2 |
CNY 3,080.00 |
|
TP304082 | Recombinant protein of human WW domain containing transcription regulator 1 (WWTR1), 20 µg |
CNY 2,900.00 |