United States
Germany
Japan
United Kingdom
China
HOMER3 (NM_004838) Human Mass Spec Standard
CAT＃: PH304168
HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_004829)
View other "HOMER3" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_004829) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204168 |
| Predicted MW | 39.9 kDa |
| Protein Sequence |
>RC204168 protein sequence
Red=Cloning site Green=Tags(s) MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAIINSTVTPNMTF TKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKSQDGGELTSPALGLASHQVPP SPLVSANGPGEEKLFRSQSADAPGPTERERLKKMLSEGSVGEVQWEAEFFALQDSNNKLAGALREANAAA AQWRQQLEAQRAEAERLRQRVAELEAQAASEVTPTGEKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTGG PREALEAAEREETQQKVQDLETRNAELEHQLRAMERSLEEARAERERARAEVGRAAQLLDVRLFELSELR EGLARLAEAAP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004829 |
| RefSeq Size | 1587 |
| RefSeq ORF | 1083 |
| Synonyms | HOMER-3; VESL3 |
| Locus ID | 9454 |
| Cytogenetics | 19p13.11 |
| Summary | This gene encodes a member of the HOMER family of postsynaptic density scaffolding proteins that share a similar domain structure consisting of an N-terminal Enabled/vasodilator-stimulated phosphoprotein homology 1 domain which mediates protein-protein interactions, and a carboxy-terminal coiled-coil domain and two leucine zipper motifs that are involved in self-oligomerization. The encoded protein binds numerous other proteins including group I metabotropic glutamate receptors, inositol 1,4,5-trisphosphate receptors and amyloid precursor proteins and has been implicated in diverse biological functions such as neuronal signaling, T-cell activation and trafficking of amyloid beta peptides. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417705 | HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428985 | HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428986 | HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428987 | HOMER3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417705 | Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 2 |
CNY 3,080.00 |
|
| LY428985 | Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 3 |
CNY 3,080.00 |
|
| LY428986 | Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 1 |
CNY 3,080.00 |
|
| LY428987 | Transient overexpression lysate of homer homolog 3 (Drosophila) (HOMER3), transcript variant 4 |
CNY 3,080.00 |
|
| PH326668 | HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_001139194) |
CNY 19,520.00 |
|
| PH326721 | HOMER3 MS Standard C13 and N15-labeled recombinant protein (NP_001139196) |
CNY 14,250.00 |
|
| TP304168 | Recombinant protein of human homer homolog 3 (Drosophila) (HOMER3), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP326668 | Recombinant protein of human homer homolog 3 (Drosophila) (HOMER3), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP326721 | Purified recombinant protein of Homo sapiens homer homolog 3 (Drosophila) (HOMER3), transcript variant 4, 20 µg |
CNY 2,900.00 |
