ID4 (NM_001546) Human Mass Spec Standard
CAT#: PH304170
ID4 MS Standard C13 and N15-labeled recombinant protein (NP_001537)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | ID4 MS Standard C13 and N15-labeled recombinant protein (NP_001537) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204170 |
Predicted MW | 16.4 kDa |
Protein Sequence |
>RC204170 representing NM_001546
Red=Cloning site Green=Tags(s) MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMND CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPL TALNTDPAGAVNKQGDSILCR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001537 |
RefSeq Size | 2389 |
RefSeq ORF | 483 |
Synonyms | bHLHb27; IDB4 |
Locus ID | 3400 |
Cytogenetics | 6p22.3 |
Summary | This gene encodes a member of the inhibitor of DNA binding (ID) protein family. The encoded protein lacks DNA binding ability, and instead regulates gene expression through binding to and inhibiting basic helix-loop-helix transcription factors. This protein has been implicated in the regulation of diverse cellular processes that play a role in development and tumorigenesis. [provided by RefSeq, Aug 2017] |
Protein Families | ES Cell Differentiation/IPS, Transcription Factors |
Protein Pathways | TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419876 | ID4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419876 | Transient overexpression lysate of inhibitor of DNA binding 4, dominant negative helix-loop-helix protein (ID4) |
CNY 3,080.00 |
|
TP304170 | Recombinant protein of human inhibitor of DNA binding 4, dominant negative helix-loop-helix protein (ID4), 20 µg |
CNY 2,900.00 |