MTRF1L (NM_019041) Human Mass Spec Standard
CAT#: PH304221
MTRF1L MS Standard C13 and N15-labeled recombinant protein (NP_061914)
View other "MTRF1L" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | MTRF1L MS Standard C13 and N15-labeled recombinant protein (NP_061914) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204221 |
Predicted MW | 43.5 kDa |
Protein Sequence |
>RC204221 protein sequence
Red=Cloning site Green=Tags(s) MRSRVLWGAARWLWPRRAVGPARRPLSSGSPPLEELFARGGPLRTFLERQAGSEAHLKVRRPELLAVIKL LNEKEQELRETEHLLHDENEDLRKLAENEITLCQKEITQLKHQIILLLVPSEETDENDLILEVTAGVGGQ EAMLFTSEIFDMYQQYAAFKRWHFETLEYFPSELGGLRHASASIGGSEAYRHMKFEGGVHRVQRVPKTEK QGRVHTSTMTVAILPQPTEINLVINPKDLRIDTKRASGAGGQHVNTTDSAVRIVHLPTGVVSECQQERSQ LKNKELAMTKLRAKLYSMHLEEEINKRQNARKIQIGSKGRSEKIRTYNFPQNRVTDHRINKTLHDLETFM QGDYLLDELVQSLKEYADYESLVEIISQKV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061914 |
RefSeq Size | 3815 |
RefSeq ORF | 1140 |
Synonyms | HMRF1L; MRF1L; mtRF1a |
Locus ID | 54516 |
Cytogenetics | 6q25.2 |
Summary | The protein encoded by this gene plays a role in mitochondrial translation termination, and is thought to be a release factor that is involved in the dissociation of the complete protein from the final tRNA, the ribosome, and the cognate mRNA. This protein acts upon UAA and UAG stop codons, but has no in vitro activity against UGA, which encodes tryptophan in human mitochondrion, or, the mitochondrial non-cognate stop codons, AGA and AGG. This protein shares sequence similarity to bacterial release factors. Pseudogenes of this gene are found on chromosomes 4, 8, and 11. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402734 | MTRF1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402734 | Transient overexpression lysate of mitochondrial translational release factor 1-like (MTRF1L), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
TP304221 | Recombinant protein of human mitochondrial translational release factor 1-like (MTRF1L), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2,900.00 |