CD27 (NM_001242) Human Mass Spec Standard
CAT#: PH304252
CD27 MS Standard C13 and N15-labeled recombinant protein (NP_001233)
View other "CD27" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CD27 MS Standard C13 and N15-labeled recombinant protein (NP_001233) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204252 |
Predicted MW | 29.2 kDa |
Protein Sequence |
>RC204252 protein sequence
Red=Cloning site Green=Tags(s) MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIPGVS FSPDHHTRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTECDPLPNPSLTARSSQALSPHP QPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFLVFTLAGALF LHQRRKYRSNKGESPVEPAEPCRYSCPREEEGSTIPIQEDYRKPEPACSP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001233 |
RefSeq Size | 1320 |
RefSeq ORF | 780 |
Synonyms | S152; S152. LPFS2; T14; TNFRSF7; Tp55 |
Locus ID | 939 |
Cytogenetics | 12p13.31 |
Summary | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400496 | CD27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400496 | Transient overexpression lysate of CD27 molecule (CD27) |
CNY 3,080.00 |
|
TP304252 | Recombinant protein of human CD27 molecule (CD27), 20 µg |
CNY 2,900.00 |
|
TP700286 | Purified recombinant protein of human CD27 molecule (CD27), with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP723936 | Human CD27 Protein, mFc-His Tag |
CNY 5,249.00 |
|
TP724010 | Human CD27 Protein, hFc Tag |
CNY 5,249.00 |