MMAB (NM_052845) Human Mass Spec Standard
CAT#: PH304290
MMAB MS Standard C13 and N15-labeled recombinant protein (NP_443077)
View other "MMAB" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | MMAB MS Standard C13 and N15-labeled recombinant protein (NP_443077) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204290 |
Predicted MW | 27.4 kDa |
Protein Sequence |
>RC204290 protein sequence
Red=Cloning site Green=Tags(s) MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSST FTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQKIQCTLQDVGSALATPCSSAREAHL KYTTFKAGPILELEQWIDKYTSQLPPLTAFILPSGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVA KFLNRLSDYLFTLARYAAMKEGNQEKIYMKNDPSAESEGL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_443077 |
RefSeq Size | 4154 |
RefSeq ORF | 750 |
Synonyms | ATR; cblB; CFAP23; cob |
Locus ID | 326625 |
Cytogenetics | 12q24.11 |
Summary | This gene encodes a protein that catalyzes the final step in the conversion of vitamin B(12) into adenosylcobalamin (AdoCbl), a vitamin B12-containing coenzyme for methylmalonyl-CoA mutase. Mutations in the gene are the cause of vitamin B12-dependent methylmalonic aciduria linked to the cblB complementation group. Alternatively spliced transcript variants have been found. [provided by RefSeq, Apr 2011] |
Protein Pathways | Metabolic pathways, Porphyrin and chlorophyll metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409455 | MMAB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409455 | Transient overexpression lysate of methylmalonic aciduria (cobalamin deficiency) cblB type (MMAB), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP304290 | Recombinant protein of human methylmalonic aciduria (cobalamin deficiency) cblB type (MMAB), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |