Syntrophin alpha 1 (SNTA1) (NM_003098) Human Mass Spec Standard
CAT#: PH304480
SNTA1 MS Standard C13 and N15-labeled recombinant protein (NP_003089)
View other "Syntrophin alpha 1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SNTA1 MS Standard C13 and N15-labeled recombinant protein (NP_003089) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204480 |
Predicted MW | 53.9 kDa |
Protein Sequence |
>RC204480 protein sequence
Red=Cloning site Green=Tags(s) MASGRRAPRTGLLELRAGAGSGAGGERWQRVLLSLAEDVLTVSPADGDPGPEPGAPREQEPAQLNGAAEP GAGPPQLPEALLLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNG EDLSSATHDEAVQVLKKTGKEVVLEVKYMKDVSPYFKNSTGGTSVGWDSPPASPLQRQPSSPGPTPRNFS EAKHMSLKMAYVSKRCTPNDPEPRYLEICSADGQDTLFLRAKDEASARSWATAIQAQVNTLTPRVKDELQ ALLAATSTAGSQDIKQIGWLTEQLPSGGTAPTLALLTEKELLLYLSLPETREALSRPARTAPLIATRLVH SGPSKGSVPYDAELSFALRTGTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRP CSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMSSDDGASLLFLDFGGAEGEIQLDLHSCPKTIVFII HSFLSAKVTRLGLLA SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003089 |
RefSeq Size | 2345 |
RefSeq ORF | 1515 |
Synonyms | dJ1187J4.5; LQT12; SNT1; TACIP1 |
Locus ID | 6640 |
Cytogenetics | 20q11.21 |
Summary | Syntrophins are cytoplasmic peripheral membrane scaffold proteins that are components of the dystrophin-associated protein complex. This gene is a member of the syntrophin gene family and encodes the most common syntrophin isoform found in cardiac tissues. The N-terminal PDZ domain of this syntrophin protein interacts with the C-terminus of the pore-forming alpha subunit (SCN5A) of the cardiac sodium channel Nav1.5. This protein also associates cardiac sodium channels with the nitric oxide synthase-PMCA4b (plasma membrane Ca-ATPase subtype 4b) complex in cardiomyocytes. This gene is a susceptibility locus for Long-QT syndrome (LQT) - an inherited disorder associated with sudden cardiac death from arrhythmia - and sudden infant death syndrome (SIDS). This protein also associates with dystrophin and dystrophin-related proteins at the neuromuscular junction and alters intracellular calcium ion levels in muscle tissue. [provided by RefSeq, Jan 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401080 | SNTA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401080 | Transient overexpression lysate of syntrophin, alpha 1 (dystrophin-associated protein A1, 59kDa, acidic component) (SNTA1) |
CNY 3,080.00 |
|
TP304480 | Recombinant protein of human syntrophin, alpha 1 (dystrophin-associated protein A1, 59kDa, acidic component) (SNTA1), 20 µg |
CNY 2,900.00 |
其它Syntrophin alpha 1产品