Psoriasin (S100A7) (NM_002963) Human Mass Spec Standard
CAT#: PH304490
S100A7 MS Standard C13 and N15-labeled recombinant protein (NP_002954)
View other "Psoriasin" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | S100A7 MS Standard C13 and N15-labeled recombinant protein (NP_002954) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204490 |
Predicted MW | 11.5 kDa |
Protein Sequence |
>RC204490 protein sequence
Red=Cloning site Green=Tags(s) MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKI DFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002954 |
RefSeq Size | 450 |
RefSeq ORF | 303 |
Synonyms | PSOR1; S100A7c |
Locus ID | 6278 |
Cytogenetics | 1q21.3 |
Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. The protein is overexpressed in hyperproliferative skin diseases, exhibits antimicrobial activities against bacteria and induces immunomodulatory activities. [provided by RefSeq, Nov 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418993 | S100A7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418993 | Transient overexpression lysate of S100 calcium binding protein A7 (S100A7) |
CNY 3,080.00 |
|
TP304490 | Recombinant protein of human S100 calcium binding protein A7 (S100A7), 20 µg |
CNY 2,900.00 |
其它Psoriasin产品