RRAS2 (NM_012250) Human Mass Spec Standard
CAT#: PH304591
RRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_036382)
View other "RRAS2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_036382) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204591 |
Predicted MW | 23.4 kDa |
Protein Sequence |
>RC204591 protein sequence
Red=Cloning site Green=Tags(s) MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTA GQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQE EGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036382 |
RefSeq Size | 2360 |
RefSeq ORF | 612 |
Synonyms | NS12; TC21 |
Locus ID | 22800 |
Cytogenetics | 11p15.2 |
Summary | This gene encodes a member of the R-Ras subfamily of Ras-like small GTPases. The encoded protein associates with the plasma membrane and may function as a signal transducer. This protein may play an important role in activating signal transduction pathways that control cell proliferation. Mutations in this gene are associated with the growth of certain tumors. Pseudogenes of this gene are found on chromosomes 1 and 2. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010] |
Protein Families | Druggable Genome |
Protein Pathways | MAPK signaling pathway, Regulation of actin cytoskeleton, Tight junction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415877 | RRAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415877 | Transient overexpression lysate of related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1 |
CNY 3,080.00 |
|
TP304591 | Recombinant protein of human related RAS viral (r-ras) oncogene homolog 2 (RRAS2), transcript variant 1, 20 µg |
CNY 2,900.00 |