FCN1 (NM_002003) Human Mass Spec Standard
CAT#: PH304637
FCN1 MS Standard C13 and N15-labeled recombinant protein (NP_001994)
View other "FCN1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FCN1 MS Standard C13 and N15-labeled recombinant protein (NP_001994) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204637 |
Predicted MW | 35.1 kDa |
Protein Sequence |
>RC204637 protein sequence
Red=Cloning site Green=Tags(s) MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIG ERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCR PLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVD FEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWY ADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001994 |
RefSeq Size | 1313 |
RefSeq ORF | 978 |
Synonyms | FCNM |
Locus ID | 2219 |
Cytogenetics | 9q34.3 |
Summary | The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found separately in other proteins such as complement protein C1q, C-type lectins known as collectins, and tenascins. However, all these proteins recognize different targets, and are functionally distinct. Ficolin 1 encoded by FCN1 is predominantly expressed in the peripheral blood leukocytes, and has been postulated to function as a plasma protein with elastin-binding activity. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400731 | FCN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400731 | Transient overexpression lysate of ficolin (collagen/fibrinogen domain containing) 1 (FCN1) |
CNY 3,080.00 |
|
TP304637 | Recombinant protein of human ficolin (collagen/fibrinogen domain containing) 1 (FCN1), 20 µg |
CNY 2,900.00 |