LHFPL6 (NM_005780) Human Mass Spec Standard
CAT#: PH304687
LHFP MS Standard C13 and N15-labeled recombinant protein (NP_005771)
View other "LHFPL6" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | LHFP MS Standard C13 and N15-labeled recombinant protein (NP_005771) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204687 |
Predicted MW | 21.6 kDa |
Protein Sequence |
>RC204687 protein sequence
Red=Cloning site Green=Tags(s) MASSLTCTGVIWALLSFLCAATSCVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGR YASFQGIPSAEWRICTIVTGLGCGLLLLVALTALMGCCVSDLISRTVGRVAGGIQFLGGLLIGAGCALYP LGWDSEEVRQTCGYTSGQFDLGKCEIGWAYYCTGAGATAAMLLCTWLACFSGKKQKHYPY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005771 |
RefSeq Size | 2180 |
RefSeq ORF | 600 |
Synonyms | LHFP |
Locus ID | 10186 |
Cytogenetics | 13q13.3-q14.11 |
Summary | This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. This gene is fused to a high-mobility group gene in a translocation-associated lipoma. Mutations in another LHFP-like gene result in deafness in humans and mice. Alternatively spliced transcript variants have been found; however, their full-length nature is not known. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417068 | LHFP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417068 | Transient overexpression lysate of lipoma HMGIC fusion partner (LHFP) |
CNY 3,080.00 |
|
TP304687 | Recombinant protein of human lipoma HMGIC fusion partner (LHFP), 20 µg |
CNY 2,900.00 |