CFHL2 (CFHR2) (NM_005666) Human Mass Spec Standard
CAT#: PH304689
CFHR2 MS Standard C13 and N15-labeled recombinant protein (NP_005657)
View other "CFHL2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | CFHR2 MS Standard C13 and N15-labeled recombinant protein (NP_005657) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204689 |
Predicted MW | 30.7 kDa |
Protein Sequence |
>RC204689 protein sequence
Red=Cloning site Green=Tags(s) MWLLVSVILISRISSVGGEAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRI TCAEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRLQNNENNISCVERGWSTPPKC RSTISAEKCGPPPPIDNGDITSFLLSVYAPGSSVEYQCQNLYQLEGNNQITCRNGQWSEPPKCLDPCVIS QEIMEKYNIKLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEEK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005657 |
RefSeq Size | 1043 |
RefSeq ORF | 810 |
Synonyms | CFHL2; FHR2; HFL3 |
Locus ID | 3080 |
Cytogenetics | 1q31.3 |
Summary | This gene belongs to a family of complement factor H-related genes (CFHR), which are clustered together with complement factor H gene on chromosome 1, and are involved in regulation of complement. Mutations in CFHR genes have been associated with dense deposit disease and atypical haemolytic-uraemic syndrome. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2015] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401729 | CFHR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401729 | Transient overexpression lysate of complement factor H-related 2 (CFHR2) |
CNY 3,080.00 |
|
TP304689 | Purified recombinant protein of Homo sapiens complement factor H-related 2 (CFHR2), 20 µg |
CNY 2,900.00 |
|
TP720675 | Purified recombinant protein of Human complement factor H-related 2 (CFHR2) |
CNY 3,140.00 |