ERK2 (MAPK1) (NM_138957) Human Mass Spec Standard
CAT#: PH304703
MAPK1 MS Standard C13 and N15-labeled recombinant protein (NP_620407)
View other "ERK2" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | MAPK1 MS Standard C13 and N15-labeled recombinant protein (NP_620407) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204703 |
Predicted MW | 41.4 kDa |
Protein Sequence |
>RC204703 protein sequence
Red=Cloning site Green=Tags(s) MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLR EIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYI HSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSID IWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFP NADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEE TARFQPGYRS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_620407 |
RefSeq Size | 1514 |
RefSeq ORF | 1080 |
Synonyms | ERK; ERK-2; ERK2; ERT1; MAPK2; NS13; p38; p40; p41; p41mapk; p42-MAPK; P42MAPK; PRKM1; PRKM2 |
Locus ID | 5594 |
Cytogenetics | 22q11.22 |
Summary | This gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene. [provided by RefSeq, Jan 2014] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Acute myeloid leukemia, Adherens junction, Alzheimer's disease, Axon guidance, B cell receptor signaling pathway, Bladder cancer, Chemokine signaling pathway, Chronic myeloid leukemia, Colorectal cancer, Dorso-ventral axis formation, Endometrial cancer, ErbB signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Gap junction, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term depression, Long-term potentiation, MAPK signaling pathway, Melanogenesis, Melanoma, mTOR signaling pathway, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Non-small cell lung cancer, Oocyte meiosis, Pancreatic cancer, Pathways in cancer, Prion diseases, Progesterone-mediated oocyte maturation, Prostate cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway, TGF-beta signaling pathway, Thyroid cancer, Toll-like receptor signaling pathway, Type II diabetes mellitus, Vascular smooth muscle contraction, VEGF signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408481 | MAPK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419132 | MAPK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408481 | Transient overexpression lysate of mitogen-activated protein kinase 1 (MAPK1), transcript variant 2 |
CNY 3,080.00 |
|
LY419132 | Transient overexpression lysate of mitogen-activated protein kinase 1 (MAPK1), transcript variant 1 |
CNY 3,080.00 |
|
PH310493 | MAPK1 MS Standard C13 and N15-labeled recombinant protein (NP_002736) |
CNY 19,520.00 |
|
TP304703 | Recombinant protein of human mitogen-activated protein kinase 1 (MAPK1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP310493 | Recombinant protein of human mitogen-activated protein kinase 1 (MAPK1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP750214 | Purified recombinant protein of Human Mitogen-activated protein kinase 1, full length(105Gly), with N-terminal fusion HA/FLAG tag, expressed in E.coli, 50ug |
CNY 1,950.00 |