CHMP4C (NM_152284) Human Mass Spec Standard
CAT#: PH304802
CHMP4C MS Standard C13 and N15-labeled recombinant protein (NP_689497)
View other "CHMP4C" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CHMP4C MS Standard C13 and N15-labeled recombinant protein (NP_689497) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204802 |
Predicted MW | 26.2 kDa |
Protein Sequence |
>RC204802 representing NM_152284
Red=Cloning site Green=Tags(s) MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALK RKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQD IAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRS RAASSQRAEEEDDDIKQLAAWAT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_689497 |
RefSeq Size | 1847 |
RefSeq ORF | 699 |
Synonyms | Shax3; SNF7-3; VPS32C |
Locus ID | 92421 |
Cytogenetics | 8q21.13 |
Summary | CHMP4C belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008] |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407666 | CHMP4C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407666 | Transient overexpression lysate of chromatin modifying protein 4C (CHMP4C) |
CNY 3,080.00 |
|
TP304802 | Recombinant protein of human chromatin modifying protein 4C (CHMP4C), 20 µg |
CNY 2,900.00 |