Thymidylate Synthase (TYMS) (NM_001071) Human Mass Spec Standard
CAT#: PH304814
TYMS MS Standard C13 and N15-labeled recombinant protein (NP_001062)
View other "Thymidylate Synthase" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | TYMS MS Standard C13 and N15-labeled recombinant protein (NP_001062) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204814 |
Predicted MW | 35.5 kDa |
Protein Sequence |
>RC204814 representing NM_001071
Red=Cloning site Green=Tags(s) MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDE FPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWR HFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSC QLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLR ILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001062 |
RefSeq Size | 1536 |
RefSeq ORF | 939 |
Synonyms | HST422; TMS; TS |
Locus ID | 7298 |
Cytogenetics | 18p11.32 |
Summary | Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using, 10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occurring antisense transcript, mitochondrial enolase superfamily member 1 (GeneID:55556), vary inversely when cell-growth progresses from late-log to plateau phase. Polymorphisms in this gene may be associated with etiology of neoplasia, including breast cancer, and response to chemotherapy. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, One carbon pool by folate, Pyrimidine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420700 | TYMS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420700 | Transient overexpression lysate of thymidylate synthetase (TYMS) |
CNY 3,080.00 |
|
TP304814 | Recombinant protein of human thymidylate synthetase (TYMS), 20 µg |
CNY 2,900.00 |
|
TP710029 | Recombinant protein of human thymidylate synthetase (TYMS), full length, with N-terminal polyhistidine tag, expressed in sf9 cells. |
CNY 4,020.00 |
其它Thymidylate Synthase产品