Carbonic Anhydrase IX (CA9) (NM_001216) Human Mass Spec Standard
CAT#: PH304839
CA9 MS Standard C13 and N15-labeled recombinant protein (NP_001207)
View other "Carbonic Anhydrase IX" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | CA9 MS Standard C13 and N15-labeled recombinant protein (NP_001207) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204839 |
Predicted MW | 49.7 kDa |
Protein Sequence |
>RC204839 protein sequence
Red=Cloning site Green=Tags(s) MAPLCPSPWLPLLIPAPAPGLTVQLLLSLLLLMPVHPQRLPRMQEDSPLGGGSSGEDDPLGEEDLPSEED SPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPGDPQEPQNNAHRDKEGDDQSH WRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFCPALRPLELLGFQLPPLPELRLRNNGHSVQLTLPPGL EMALGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLE EGPEENSAYEQLLSRLEEIAEEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVM LSAKQLHTLSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCLAAGDILALVF GLLFAVTSVAFLVQMRRQHRRGTKGGVSYRPAEVAETGA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001207 |
RefSeq Size | 1561 |
RefSeq ORF | 1377 |
Synonyms | CAIX; MN |
Locus ID | 768 |
Cytogenetics | 9p13.3 |
Summary | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IX is a transmembrane protein and is one of only two tumor-associated carbonic anhydrase isoenzymes known. It is expressed in all clear-cell renal cell carcinoma, but is not detected in normal kidney or most other normal tissues. It may be involved in cell proliferation and transformation. This gene was mapped to 17q21.2 by fluorescence in situ hybridization, however, radiation hybrid mapping localized it to 9p13-p12. [provided by RefSeq, Jun 2014] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Nitrogen metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400485 | CA9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400485 | Transient overexpression lysate of carbonic anhydrase IX (CA9) |
CNY 3,080.00 |
|
TP304839 | Recombinant protein of human carbonic anhydrase IX (CA9), 20 µg |
CNY 2,900.00 |
|
TP701019 | Purified recombinant protein of Human carbonic anhydrase IX (CA9), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7,106.00 |
其它Carbonic Anhydrase IX产品