Sprouty 2 (SPRY2) (NM_005842) Human Mass Spec Standard
CAT#: PH304864
SPRY2 MS Standard C13 and N15-labeled recombinant protein (NP_005833)
View other "Sprouty 2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SPRY2 MS Standard C13 and N15-labeled recombinant protein (NP_005833) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204864 |
Predicted MW | 34.7 kDa |
Protein Sequence |
>RC204864 protein sequence
Red=Cloning site Green=Tags(s) MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPTVVPRPGLKPA PRPSTQHKHERLHGLPEHRQPPRLQHSQVHSSARAPLSRSISTVSSGSRSSTRTSTSSSSSEQRLLGSSF SSGPVADGIIRVQPKSELKPGELKPLSKEDLGLHAYRCEDCGKCKCKECTYPRPLPSDWICDKQCLCSAQ NVIDYGTCVCCVKGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQ GCYDRVNRPGCRCKNSNTVCCKVPTVPPRNFEKPT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005833 |
RefSeq Size | 2126 |
RefSeq ORF | 945 |
Synonyms | hSPRY2; IGAN3 |
Locus ID | 10253 |
Cytogenetics | 13q31.1 |
Summary | This gene encodes a protein belonging to the sprouty family. The encoded protein contains a carboxyl-terminal cysteine-rich domain essential for the inhibitory activity on receptor tyrosine kinase signaling proteins and is required for growth factor stimulated translocation of the protein to membrane ruffles. In primary dermal endothelial cells this gene is transiently upregulated in response to fibroblast growth factor two. This protein is indirectly involved in the non-cell autonomous inhibitory effect on fibroblast growth factor two signaling. The protein interacts with Cas-Br-M (murine) ectropic retroviral transforming sequence, and can function as a bimodal regulator of epidermal growth factor receptor/mitogen-activated protein kinase signaling. This protein may play a role in alveoli branching during lung development as shown by a similar mouse protein. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Jak-STAT signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401772 | SPRY2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401772 | Transient overexpression lysate of sprouty homolog 2 (Drosophila) (SPRY2) |
CNY 3,080.00 |
|
TP304864 | Recombinant protein of human sprouty homolog 2 (Drosophila) (SPRY2), 20 µg |
CNY 2,900.00 |
其它Sprouty 2产品