ARF4 (NM_001660) Human Mass Spec Standard
CAT#: PH304984
ARF4 MS Standard C13 and N15-labeled recombinant protein (NP_001651)
View other "ARF4" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | ARF4 MS Standard C13 and N15-labeled recombinant protein (NP_001651) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204984 |
Predicted MW | 20.5 kDa |
Protein Sequence |
>RC204984 protein sequence
Red=Cloning site Green=Tags(s) MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGG QDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMT DKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001651 |
RefSeq Size | 1758 |
RefSeq ORF | 540 |
Synonyms | ARF2 |
Locus ID | 378 |
Cytogenetics | 3p14.3 |
Summary | This gene is a member of the human ARF gene family whose members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 5 ARF proteins and 11 ARF-like proteins and constitute one family of the RAS superfamily. The ARF proteins are categorized as class I, class II and class III; this gene is a class II member. The members of each class share a common gene organization. The ARF4 gene spans approximately 12kb and contains six exons and five introns. This gene is the most divergent member of the human ARFs. Conflicting map positions at 3p14 or 3p21 have been reported for this gene. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Class II ADP-ribosylation Factors Are Required for Efficient Secretion of Dengue Viruses
,null,
The Journal of Biological Chemistry
,PubMed ID 22105072
[ARF4]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400627 | ARF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400627 | Transient overexpression lysate of ADP-ribosylation factor 4 (ARF4) |
CNY 3,080.00 |
|
TP304984 | Recombinant protein of human ADP-ribosylation factor 4 (ARF4), 20 µg |
CNY 2,900.00 |