PPP1R1C (NM_001080545) Human Mass Spec Standard
CAT#: PH305047
PPP1R1C MS Standard C13 and N15-labeled recombinant protein (NP_001074014)
View other "PPP1R1C" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PPP1R1C MS Standard C13 and N15-labeled recombinant protein (NP_001074014) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205047 |
Predicted MW | 12.3 kDa |
Protein Sequence |
>RC205047 protein sequence
Red=Cloning site Green=Tags(s) MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRK QSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001074014 |
RefSeq Size | 1078 |
RefSeq ORF | 327 |
Synonyms | IPP5 |
Locus ID | 151242 |
Cytogenetics | 2q31.3-q32.1 |
Summary | Protein phosphatase-1 (PP1) is a major serine/threonine phosphatase that regulates a variety of cellular functions. PP1 consists of a catalytic subunit (see PPP1CA; MIM 176875) and regulatory subunits that determine the subcellular localization of PP1 or regulate its function. PPP1R1C belongs to a group of PP1 inhibitory subunits that are themselves regulated by phosphorylation (Wang et al., 2008 [PubMed 18310074]).[supplied by OMIM, Feb 2010] |
Protein Families | Druggable Genome, Phosphatase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421099 | PPP1R1C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421099 | Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C) |
CNY 3,080.00 |
|
TP305047 | Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 1C (PPP1R1C), 20 µg |
CNY 2,900.00 |
其它PPP1R1C产品