Thymosin beta 10 (TMSB10) (NM_021103) Human Mass Spec Standard

Specifications

Product Data
Description	TMSB10 MS Standard C13 and N15-labeled recombinant protein (NP_066926)
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	RC205097
Predicted MW	5 kDa
Protein Sequence	Sequence Link (showhide) >RC205097 protein sequence Red=Cloning site Green=Tags(s) MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS myc-FLAG tag
Tag	C-Myc/DDK
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration	>0.05 µg/µL as determined by microplate BCA method
Labeling Method	Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3
Reference Data
RefSeq	NP_066926
RefSeq Size	482
RefSeq ORF	132
Synonyms	MIG12; TB10
Locus ID	9168
Cytogenetics	2p11.2
Summary	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization (By similarity).[UniProtKB/Swiss-Prot Function]

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.