FABP6 (NM_001445) Human Mass Spec Standard
CAT#: PH305307
FABP6 MS Standard C13 and N15-labeled recombinant protein (NP_001436)
View other "FABP6" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FABP6 MS Standard C13 and N15-labeled recombinant protein (NP_001436) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205307 |
Predicted MW | 14.4 kDa |
Protein Sequence |
>RC205307 protein sequence
Red=Cloning site Green=Tags(s) MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKES NIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001436 |
RefSeq Size | 587 |
RefSeq ORF | 384 |
Synonyms | I-15P; I-BABP; I-BALB; I-BAP; ILBP; ILBP3; ILLBP |
Locus ID | 2172 |
Cytogenetics | 5q33.3 |
Summary | This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419932 | FABP6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419932 | Transient overexpression lysate of fatty acid binding protein 6, ileal (FABP6), transcript variant 2 |
CNY 3,080.00 |
|
TP305307 | Recombinant protein of human fatty acid binding protein 6, ileal (FABP6), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP720196 | Recombinant protein of human fatty acid binding protein 6, ileal (FABP6), transcript variant 1 |
CNY 1,800.00 |