RAB18 (NM_021252) Human Mass Spec Standard
CAT#: PH305505
RAB18 MS Standard C13 and N15-labeled recombinant protein (NP_067075)
View other "RAB18" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RAB18 MS Standard C13 and N15-labeled recombinant protein (NP_067075) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205505 |
Predicted MW | 23 kDa |
Protein Sequence |
>RC205505 protein sequence
Red=Cloning site Green=Tags(s) MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERF RTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFA RKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_067075 |
RefSeq Size | 5003 |
RefSeq ORF | 618 |
Synonyms | RAB18LI1; WARBM3 |
Locus ID | 22931 |
Cytogenetics | 10p12.1 |
Summary | The protein encoded by this gene is a member of a family of Ras-related small GTPases that regulate membrane trafficking in organelles and transport vesicles. Knockdown studies is zebrafish suggest that this protein may have a role in eye and brain development. Mutations in this gene are associated with Warburg micro syndrome type 3. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402861 | RAB18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402861 | Transient overexpression lysate of RAB18, member RAS oncogene family (RAB18) |
CNY 3,080.00 |
|
TP305505 | Recombinant protein of human RAB18, member RAS oncogene family (RAB18), 20 µg |
CNY 2,900.00 |