United States
Germany
Japan
United Kingdom
China
Troponin I fast skeletal muscle (TNNI2) (NM_003282) Human Mass Spec Standard
CAT＃: PH305676
TNNI2 MS Standard C13 and N15-labeled recombinant protein (NP_003273)
View other "Troponin I fast skeletal muscle" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 3,990.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | TNNI2 MS Standard C13 and N15-labeled recombinant protein (NP_003273) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205676 |
| Predicted MW | 21.3 kDa |
| Protein Sequence |
>RC205676 protein sequence
Red=Cloning site Green=Tags(s) MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHA KIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRAN LKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFESES myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003273 |
| RefSeq Size | 738 |
| RefSeq ORF | 546 |
| Synonyms | AMCD2B; DA2B; DA2B1; FSSV; fsTnI |
| Locus ID | 7136 |
| Cytogenetics | 11p15.5 |
| Summary | This gene encodes a fast-twitch skeletal muscle protein, a member of the troponin I gene family, and a component of the troponin complex including troponin T, troponin C and troponin I subunits. The troponin complex, along with tropomyosin, is responsible for the calcium-dependent regulation of striated muscle contraction. Mouse studies show that this component is also present in vascular smooth muscle and may play a role in regulation of smooth muscle function. In addition to muscle tissues, this protein is found in corneal epithelium, cartilage where it is an inhibitor of angiogenesis to inhibit tumor growth and metastasis, and mammary gland where it functions as a co-activator of estrogen receptor-related receptor alpha. This protein also suppresses tumor growth in human ovarian carcinoma. Mutations in this gene cause myopathy and distal arthrogryposis type 2B. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418789 | TNNI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429022 | TNNI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429025 | TNNI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418789 | Transient overexpression lysate of troponin I type 2 (skeletal, fast) (TNNI2), transcript variant 1 |
CNY 3,080.00 |
|
| LY429022 | Transient overexpression lysate of troponin I type 2 (skeletal, fast) (TNNI2), transcript variant 2 |
CNY 3,080.00 |
|
| LY429025 | Transient overexpression lysate of troponin I type 2 (skeletal, fast) (TNNI2), transcript variant 3 |
CNY 3,080.00 |
|
| PH327419 | TNNI2 MS Standard C13 and N15-labeled recombinant protein (NP_001139301) |
CNY 19,520.00 |
|
| TP305676 | Recombinant protein of human troponin I type 2 (skeletal, fast) (TNNI2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP327419 | Recombinant protein of human troponin I type 2 (skeletal, fast) (TNNI2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP701243 | Purified recombinant protein of Human troponin I type 2 (skeletal, fast) (TNNI2), transcript variant 1, full length, with N-terminal DDK tag, expressed in HEK293 cells, 20ug |
CNY 2,900.00 |
其它Troponin I fast skeletal muscle产品
