SNX21 (NM_152897) Human Mass Spec Standard
CAT#: PH305765
SNX21 MS Standard C13 and N15-labeled recombinant protein (NP_690857)
View other "SNX21" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SNX21 MS Standard C13 and N15-labeled recombinant protein (NP_690857) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205765 |
Predicted MW | 21.9 kDa |
Protein Sequence |
>RC205765 protein sequence
Red=Cloning site Green=Tags(s) MHRGTQEGAMASRLLHRLRHALAGDGPGEAAASPEAEQFPESSELEDDDAEGLSSRLSGTLSFTSAEDDE DDEDEDDEEAGPDQLPLGDGTSGEDAERSPPPDGQWGSQLLARQLQDFWKKSRNTLAPQRLLFEVTSANV VKDPPSKYVLYTLTVIGPGPPDCQPAQISRRYSDFERLHRNLQRQFRGPMAAISFPQSH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_690857 |
RefSeq Size | 1921 |
RefSeq ORF | 597 |
Synonyms | C20orf161; dJ337O18.4; PP3993; SNX-L; SNXL |
Locus ID | 90203 |
Cytogenetics | 20q13.12 |
Summary | This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. The specific function of this protein has not been determined. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407259 | SNX21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407259 | Transient overexpression lysate of sorting nexin family member 21 (SNX21), transcript variant 2 |
CNY 3,080.00 |
|
TP305765 | Recombinant protein of human sorting nexin family member 21 (SNX21), transcript variant 2, 20 µg |
CNY 2,900.00 |