PPP1R14A (NM_033256) Human Mass Spec Standard
CAT#: PH305799
PPP1R14A MS Standard C13 and N15-labeled recombinant protein (NP_150281)
View other "PPP1R14A" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PPP1R14A MS Standard C13 and N15-labeled recombinant protein (NP_150281) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205799 |
Predicted MW | 16.7 kDa |
Protein Sequence |
>RC205799 protein sequence
Red=Cloning site Green=Tags(s) MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELYRGMEAD MPDEINIDELLELESEEERSRKIQGLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLSPLQD RARTAHP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_150281 |
RefSeq Size | 782 |
RefSeq ORF | 441 |
Synonyms | CPI-17; CPI17; PPP1INL |
Locus ID | 94274 |
Cytogenetics | 19q13.2 |
Summary | The protein encoded by this gene belongs to the protein phosphatase 1 (PP1) inhibitor family. This protein is an inhibitor of smooth muscle myosin phosphatase, and has higher inhibitory activity when phosphorylated. Inhibition of myosin phosphatase leads to increased myosin phosphorylation and enhanced smooth muscle contraction. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Vascular smooth muscle contraction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403236 | PPP1R14A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403236 | Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 14A (PPP1R14A) |
CNY 3,080.00 |
|
TP305799 | Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 14A (PPP1R14A), 20 µg |
CNY 2,900.00 |
|
TP720140 | Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 14A (PPP1R14A) |
CNY 3,140.00 |
其它PPP1R14A产品