CACNG6 (NM_145814) Human Mass Spec Standard
CAT#: PH305809
CACNG6 MS Standard C13 and N15-labeled recombinant protein (NP_665813)
View other "CACNG6" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CACNG6 MS Standard C13 and N15-labeled recombinant protein (NP_665813) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205809 |
Predicted MW | 27.9 kDa |
Protein Sequence |
>RC205809 representing NM_145814
Red=Cloning site Green=Tags(s) MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKA NGSAVCEAAHLGLWKACTKRLWQADVPVDRDTCGPAELPGEANCTYFKFFTTGENARIFQRTTKKEVNLA AAVIAVLGLAVMALGCLCIIMVLSKGAEFLLRVGAVCFGLSGLLLLVSLEVFRHSVRALLQRVSPEPPPA PRLTYEYSWSLGCGVGAGLILLLGAGCFLLLTLPSWPWGSLCPKRGHRAT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_665813 |
RefSeq Size | 1886 |
RefSeq ORF | 780 |
Locus ID | 59285 |
Cytogenetics | 19q13.42 |
Summary | Voltage-dependent calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of two known gamma subunit proteins. This particular gamma subunit is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members that function as transmembrane AMPA receptor regulatory proteins (TARPs). Alternative splicing results in multiple transcript variants. Variants in this gene have been associated with aspirin-intolerant asthma. [provided by RefSeq, Dec 2010] |
Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Protein Pathways | Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407851 | CACNG6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407852 | CACNG6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407851 | Transient overexpression lysate of calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1 |
CNY 3,080.00 |
|
LY407852 | Transient overexpression lysate of calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 2 |
CNY 3,080.00 |
|
TP305809 | Recombinant protein of human calcium channel, voltage-dependent, gamma subunit 6 (CACNG6), transcript variant 1, 20 µg |
CNY 2,900.00 |