CEBP Beta (CEBPB) (NM_005194) Human Mass Spec Standard
CAT#: PH305882
CEBPB MS Standard C13 and N15-labeled recombinant protein (NP_005185)
View other "CEBP Beta" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CEBPB MS Standard C13 and N15-labeled recombinant protein (NP_005185) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205882 |
Predicted MW | 35.9 kDa |
Protein Sequence |
>RC205882 representing NM_005194
Red=Cloning site Green=Tags(s) MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHE RAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYV SLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAY LGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRER NNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005185 |
RefSeq Size | 1837 |
RefSeq ORF | 1035 |
Synonyms | C/EBP-beta; IL6DBP; NF-IL6; TCF5 |
Locus ID | 1051 |
Cytogenetics | 20q13.13 |
Summary | This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions. [provided by RefSeq, Oct 2013] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417451 | CEBPB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417451 | Transient overexpression lysate of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) |
CNY 3,080.00 |
|
TP305882 | Recombinant protein of human CCAAT/enhancer binding protein (C/EBP), beta (CEBPB), 20 µg |
CNY 2,900.00 |
其它CEBP Beta产品