HMG1 (HMGB1) (NM_002128) Human Mass Spec Standard
CAT#: PH305918
HMGB1 MS Standard C13 and N15-labeled recombinant protein (NP_002119)
View other "HMG1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HMGB1 MS Standard C13 and N15-labeled recombinant protein (NP_002119) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205918 |
Predicted MW | 24.9 kDa |
Protein Sequence |
>RC205918 protein sequence
Red=Cloning site Green=Tags(s) MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKAR YEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADD KQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEE DDDDE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002119 |
RefSeq Size | 3428 |
RefSeq ORF | 645 |
Synonyms | HMG-1; HMG1; HMG3; SBP-1 |
Locus ID | 3146 |
Cytogenetics | 13q12.3 |
Summary | This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Base excision repair |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400775 | HMGB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400775 | Transient overexpression lysate of high-mobility group box 1 (HMGB1) |
CNY 3,080.00 |
|
TP305918 | Recombinant protein of human high-mobility group box 1 (HMGB1), 20 µg |
CNY 2,900.00 |
|
TP720309 | Recombinant protein of human high-mobility group box 1 (HMGB1) |
CNY 3,140.00 |
|
TP721133 | Purified recombinant protein of Human high mobility group box 1 (HMGB1) |
CNY 3,140.00 |
|
TP721198 | Purified recombinant protein of Human high mobility group box 1 (HMGB1) |
CNY 3,140.00 |
|
TP762387 | Purified recombinant protein of Human high mobility group box 1 (HMGB1), full length, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |