Metallothionein (MT1A) (NM_005946) Human Mass Spec Standard
CAT#: PH305942
MT1A MS Standard C13 and N15-labeled recombinant protein (NP_005937)
View other "Metallothionein" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MT1A MS Standard C13 and N15-labeled recombinant protein (NP_005937) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205942 |
Predicted MW | 6.1 kDa |
Protein Sequence |
>RC205942 protein sequence
Red=Cloning site Green=Tags(s) MDPNCSCATGGSCTCTGSCKCKECKCNSCKKSCCSCCPMSCAKCAQGCICKGASEKCSCCA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005937 |
RefSeq Size | 468 |
RefSeq ORF | 183 |
Synonyms | MT-1A; MT-IA; MT1; MT1S; MTC |
Locus ID | 4489 |
Cytogenetics | 16q13 |
Summary | This gene is a member of the metallothionein family of genes. Proteins encoded by this gene family are low in molecular weight, are cysteine-rich, lack aromatic residues, and bind divalent heavy metal ions. The conserved cysteine residues co-ordinate metal ions using mercaptide linkages. These proteins act as anti-oxidants, protect against hydroxyl free radicals, are important in homeostatic control of metal in the cell, and play a role in detoxification of heavy metals. Disruption of two metallothionein genes in mouse resulted in defects in protection against heavy metals, oxidative stress, immune reactions, carcinogens, and displayed obesity. [provided by RefSeq, Sep 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416963 | MT1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416963 | Transient overexpression lysate of metallothionein 1A (MT1A) |
CNY 3,080.00 |
|
TP305942 | Recombinant protein of human metallothionein 1A (MT1A), 20 µg |
CNY 2,900.00 |
其它Metallothionein产品